PTGR2 antibody (Prostaglandin Reductase 2) (Middle Region)

Details for Product anti-PTGR2 Antibody No. ABIN631563
Antigen
Epitope
Middle Region
10
10
8
6
4
2
2
2
2
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
70
34
33
3
2
2
1
1
1
1
Host
Rabbit
68
2
1
Clonality
Polyclonal
Conjugate
This PTGR2 antibody is un-conjugated
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
51
35
27
13
9
4
3
1
1
1
Options
Immunogen ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
Specificity ZADH1 antibody was raised against the middle region of Zadh1
Purification Affinity purified
Antigen
Alternative Name ZADH1 (PTGR2 Antibody Abstract)
Background ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
Molecular Weight 38 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ZADH1 Blocking Peptide, catalog no. 33R-4040, is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Prostaglandin Reductase 2 (PTGR2) (Middle Region) antibody (ABIN631563) ZADH1 antibody used at 1 ug/ml to detect target protein.