PTGR2 antibody (Middle Region)
-
- Target See all PTGR2 Antibodies
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZADH1 antibody was raised against the middle region of Zadh1
- Purification
- Affinity purified
- Immunogen
- ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
- Top Product
- Discover our top product PTGR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZADH1 Blocking Peptide, catalog no. 33R-4040, is also available for use as a blocking control in assays to test for specificity of this ZADH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGR2 (Prostaglandin Reductase 2 (PTGR2))
- Alternative Name
- ZADH1 (PTGR2 Products)
- Background
- ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
- Molecular Weight
- 38 kDa (MW of target protein)
-