FBXO27 antibody (Middle Region)

Catalog No. ABIN631723

Product Details anti-FBXO27 Antibody

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO27 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO27 antibody was raised against the middle region of FBXO27

Purification: Affinity purified

Immunogen: FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO27 Blocking Peptide, catalog no. 33R-4851, is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO27

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Alternative Name: FBXO27 (FBXO27 Products)

Synonyms: MGC145578 antibody, FBG5 antibody, Fbx27 antibody, E130008B10Rik antibody, Gm161 antibody, F-box protein 27 S homeolog antibody, F-box protein 27 antibody, fbxo27.S antibody, fbxo27 antibody, FBXO27 antibody, Fbxo27 antibody

Background: Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 31 kDa (MW of target protein)