F-Box Protein 27 (FBXO27) (Middle Region) antibody

Details for Product No. ABIN631723
Middle Region
Western Blotting (WB)
Immunogen FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG
Specificity FBXO27 antibody was raised against the middle region of FBXO27
Purification Affinity purified
Alternative Name FBXO27 (FBXO27 Antibody Abstract)
Background Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Molecular Weight 31 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

FBXO27 Blocking Peptide, catalog no. 33R-4851, is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-F-Box Protein 27 (FBXO27) (Middle Region) antibody (ABIN631723) FBXO27 antibody used at 1 ug/ml to detect target protein.