Kallikrein 13 antibody (Middle Region)

Catalog No. ABIN631838

Product Details anti-Kallikrein 13 Antibody

Target: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kallikrein 13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLK13 antibody was raised against the middle region of KLK13

Purification: Affinity purified

Immunogen: KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK13 Blocking Peptide, catalog no. 33R-9689, is also available for use as a blocking control in assays to test for specificity of this KLK13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kallikrein 13

Target: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Alternative Name: KLK13 (KLK13 Products)

Synonyms: KLK-L4 antibody, KLKL4 antibody, Egfbp-2 antibody, mGk-13 antibody, kallikrein related peptidase 13 antibody, kallikrein related-peptidase 13 antibody, KLK13 antibody, Klk13 antibody

Background: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Complement System