MAP3K14 antibody (N-Term)
-
- Target See all MAP3K14 Antibodies
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAP3K14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAP3 K14 antibody was raised against the N terminal of MAP3 14
- Purification
- Affinity purified
- Immunogen
- MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
- Top Product
- Discover our top product MAP3K14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
- Alternative Name
- MAP3K14 (MAP3K14 Products)
- Synonyms
- FTDCR1B antibody, HS antibody, HSNIK antibody, NIK antibody, F23F1.4 antibody, F23F1_4 antibody, mitogen-activated protein kinase kinase kinase 14 antibody, Nik antibody, aly antibody, mitogen-activated protein kinase kinase kinase 14 antibody, MAP3K14 antibody, Map3k14 antibody, MAPKKK14 antibody
- Background
- This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, TCR Signaling
-