MAP3K14 antibody (Mitogen-Activated Protein Kinase Kinase Kinase 14) (N-Term)

Details for Product anti-MAP3K14 Antibody No. ABIN632058
Antigen
  • FTDCR1B
  • HS
  • HSNIK
  • NIK
  • F23F1.4
  • F23F1_4
  • mitogen-activated protein kinase kinase kinase 14
  • Nik
  • aly
  • mitogen-activated protein kinase kinase kinase 14
  • MAP3K14
  • Map3k14
  • MAPKKK14
Epitope
N-Term
23
15
9
9
7
7
7
5
4
3
2
2
2
1
1
1
1
1
1
Reactivity
Human
100
53
39
6
4
2
2
2
2
1
1
1
Host
Rabbit
112
3
Clonality
Polyclonal
Conjugate
This MAP3K14 antibody is un-conjugated
8
7
6
5
5
5
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
91
52
28
13
6
6
4
3
1
1
Options
Immunogen MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
Specificity MAP3 K14 antibody was raised against the N terminal of MAP3 14
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others MAP3K14 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name MAP3K14 (MAP3K14 Antibody Abstract)
Background This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
Molecular Weight 104 kDa (MW of target protein)
Pathways NF-kappaB Signaling, TCR Signaling
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14) (N-Term) antibody (ABIN632058) MAP3K14 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?