Kallikrein 2 antibody (Middle Region)
-
- Target See all Kallikrein 2 (KLK2) Antibodies
- Kallikrein 2 (KLK2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Kallikrein 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLK2 antibody was raised against the middle region of KLK2
- Purification
- Affinity purified
- Immunogen
- KLK2 antibody was raised using the middle region of KLK2 corresponding to a region with amino acids KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG
- Top Product
- Discover our top product KLK2 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLK2 Blocking Peptide, catalog no. 33R-4419, is also available for use as a blocking control in assays to test for specificity of this KLK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kallikrein 2 (KLK2)
- Alternative Name
- KLK2 (KLK2 Products)
- Synonyms
- KLK2A2 antibody, hGK-1 antibody, hK2 antibody, KLK2 antibody, Ton antibody, rGK-2 antibody, Klk2 antibody, kallikrein related peptidase 2 antibody, kallikrein-related peptidase 2 antibody, kallikrein-2 antibody, kallikrein 1-related peptidase C2 antibody, KLK2 antibody, LOC748637 antibody, Klk1c2 antibody, LOC100716976 antibody
- Background
- Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Complement System
-