TBC1D24 antibody (TBC1 Domain Family, Member 24) (Middle Region)

Details for Product anti-TBC1D24 Antibody No. ABIN632637
Target
Binding Specificity
Middle Region
4
1
1
Reactivity
Human
8
2
2
2
2
1
1
1
Host
Rabbit
8
Clonality
Polyclonal
Conjugate
This TBC1D24 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
5
3
1
1
1
1
Options
Immunogen TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
Specificity TBC1 D24 antibody was raised against the middle region of TBC1 24
Purification Affinity purified
Target
Alternative Name TBC1D24 (TBC1D24 Antibody Abstract)
Background TBC1D24 may act as a GTPase-activating protein for Rab family proteins.
Molecular Weight 62 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TBC1D24 Blocking Peptide, catalog no. 33R-8365, is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-TBC1 Domain Family, Member 24 (TBC1D24) (Middle Region) antibody (ABIN632637) TBC1D24 antibody used at 1 ug/ml to detect target protein.