Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TBC1D24 antibody (TBC1 Domain Family, Member 24) (Middle Region) Primary Antibody

TBC1D24 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632637
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    TBC1D24
    Binding Specificity
    Middle Region
    • 4
    • 1
    • 1
    Reactivity
    Human
    • 8
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This TBC1D24 antibody is un-conjugated
    • 5
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    Specificity
    TBC1 D24 antibody was raised against the middle region of TBC1 24
    Purification
    Affinity purified
    Immunogen
    TBC1 D24 antibody was raised using the middle region of TBC1 24 corresponding to a region with amino acids SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    TBC1D24 Blocking Peptide, catalog no. 33R-8365, is also available for use as a blocking control in assays to test for specificity of this TBC1D24 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 24 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    TBC1D24
    Alternative Name
    TBC1D24 (TBC1D24 Antibody Abstract)
    Synonyms
    RGD1306143, EIEE16, FIME, TLDC6, 9630033P11, C530046L02Rik, mKIAA1171, tbc1d24, TBC1 domain family, member 24, ATPase H+ transporting V0 subunit c, TBC1 domain family member 24, TBC1 domain family member 24 L homeolog, Tbc1d24, ATP6V0C, TBC1D24, tbc1d24.1.L
    Background
    TBC1D24 may act as a GTPase-activating protein for Rab family proteins.
    Molecular Weight
    62 kDa (MW of target protein)
You are here:
help Support