Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

LARP1 antibody (N-Term)

LARP1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633490
$836.98
Plus shipping costs $45.00
100 μL
Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target See all LARP1 Antibodies
    LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
    Binding Specificity
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 15
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Human
    Host
    • 13
    • 2
    Rabbit
    Clonality
    • 15
    Polyclonal
    Application
    • 15
    • 3
    • 3
    • 3
    • 3
    • 2
    Western Blotting (WB)
    Specificity
    LARP1 antibody was raised against the N terminal of LARP1
    Purification
    Affinity purified
    Immunogen
    LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    LARP1 Blocking Peptide, catalog no. 33R-3771, is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
    Alternative Name
    LARP1 (LARP1 Products)
    Synonyms
    RGD1306683, wu:fb92d03, wu:fd15e07, 3110040D16RIK, MGC98945, LARP, 1810024J12Rik, 3110040D16Rik, Larp, mKIAA0731, La ribonucleoprotein domain family, member 1, La ribonucleoprotein domain family member 1, La ribonucleoprotein domain family member 1 L homeolog, Larp1, larp1, LARP1, larp1.L
    Background
    LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
    Molecular Weight
    116 kDa (MW of target protein)
    Pathways
    SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection
You are here:
Support