LARP1 antibody (N-Term)
-
- Target See all LARP1 Antibodies
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LARP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LARP1 antibody was raised against the N terminal of LARP1
- Purification
- Affinity purified
- Immunogen
- LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
- Top Product
- Discover our top product LARP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LARP1 Blocking Peptide, catalog no. 33R-3771, is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
- Alternative Name
- LARP1 (LARP1 Products)
- Synonyms
- RGD1306683 antibody, wu:fb92d03 antibody, wu:fd15e07 antibody, 3110040D16RIK antibody, MGC98945 antibody, LARP antibody, 1810024J12Rik antibody, 3110040D16Rik antibody, Larp antibody, mKIAA0731 antibody, La ribonucleoprotein domain family, member 1 antibody, La ribonucleoprotein domain family member 1 antibody, La ribonucleoprotein domain family member 1 L homeolog antibody, Larp1 antibody, larp1 antibody, LARP1 antibody, larp1.L antibody
- Background
- LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
- Molecular Weight
- 116 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection
-