Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Ribonuclease T2 (RNASET2) (Middle Region) antibody Primary Antibody

RNASET2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633593
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Ribonuclease T2 (RNASET2)
    Binding Specificity
    Middle Region
    Reactivity
    Human
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    Un-conjugated
    Application
    Western Blotting (WB)
    Specificity
    RNASET2 antibody was raised against the middle region of RNASET2
    Purification
    Affinity purified
    Immunogen
    RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Ribonuclease T2 (RNASET2)
    Alternative Name
    RNASET2 (RNASET2 Antibody Abstract)
    Synonyms
    RNASE6PL, bA514O12.3, MGC83874, MGC145364, dre2, wu:fc10c06, zgc:113369, ribonuclease T2, ribonuclease T2 L homeolog, ribonuclease t2, RNASET2, Rnaset2, rnaset2.L, rnaset2, TM1040_2631, RPE_1409, Bind_1696, Dd586_2225, Nhal_0810, Snov_2442, Fbal_2689, Nitsa_0808, Mesop_3495
    Background
    This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
    Molecular Weight
    29 kDa (MW of target protein)
You are here: