RNASET2 antibody (Middle Region)

Catalog No. ABIN633593

Product Details anti-RNASET2 Antibody

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNASET2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNASET2 antibody was raised against the middle region of RNASET2

Purification: Affinity purified

Immunogen: RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNASET2

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Alternative Name: RNASET2 (RNASET2 Products)

Synonyms: RNASE6PL antibody, bA514O12.3 antibody, MGC83874 antibody, MGC145364 antibody, dre2 antibody, wu:fc10c06 antibody, zgc:113369 antibody, ribonuclease T2 antibody, ribonuclease T2 L homeolog antibody, ribonuclease t2 antibody, RNASET2 antibody, Rnaset2 antibody, rnaset2.L antibody, rnaset2 antibody, TM1040_2631 antibody, RPE_1409 antibody, Bind_1696 antibody, Dd586_2225 antibody, Nhal_0810 antibody, Snov_2442 antibody, Fbal_2689 antibody, Nitsa_0808 antibody, Mesop_3495 antibody

Background: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.

Molecular Weight: 29 kDa (MW of target protein)