TRPV4 antibody (Middle Region)
-
- Target See all TRPV4 Antibodies
- TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPV4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPV4 antibody was raised against the middle region of TRPV4
- Purification
- Affinity purified
- Immunogen
- TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
- Top Product
- Discover our top product TRPV4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPV4 Blocking Peptide, catalog no. 33R-8239, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))
- Alternative Name
- TRPV4 (TRPV4 Products)
- Background
- TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.
- Molecular Weight
- 91 kDa (MW of target protein)
- Pathways
- Hormone Transport, Cell-Cell Junction Organization
-