TRPV4 antibody (Transient Receptor Potential Cation Channel, Subfamily V, Member 4) (Middle Region)

Details for Product anti-TRPV4 Antibody No. ABIN633737
Antigen
  • wu:fp52e02
  • CMT2C
  • HMSN2C
  • OTRPC4
  • SMAL
  • SPSMA
  • SSQTL1
  • TRP12
  • VRL2
  • VROAC
  • 0610033B08Rik
  • Trp12
  • VR-OAC
  • VRL-2
  • Otrpc4
  • Vroac
  • transient receptor potential cation channel, subfamily V, member 4
  • transient receptor potential cation channel subfamily V member 4
  • trpv4
  • TRPV4
  • Trpv4
Epitope
Middle Region
16
14
8
7
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
Reactivity
Human
106
65
63
7
7
6
4
3
2
2
2
1
1
Host
Rabbit
109
6
1
Clonality
Polyclonal
Conjugate
This TRPV4 antibody is un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
82
41
40
14
13
6
2
1
1
Options
Immunogen TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Specificity TRPV4 antibody was raised against the middle region of TRPV4
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others TRPV4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name TRPV4 (TRPV4 Antibody Abstract)
Background TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.
Molecular Weight 91 kDa (MW of target protein)
Pathways Hormone Transport, Cell-Cell Junction Organization
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TRPV4 Blocking Peptide, catalog no. 33R-8239, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4) (Middle Region) antibody (ABIN633737) TRPV4 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?