TRPV4 antibody (Transient Receptor Potential Cation Channel, Subfamily V, Member 4) (Middle Region)

Details for Product anti-TRPV4 Antibody No. ABIN633742
Antigen
  • wu:fp52e02
  • CMT2C
  • HMSN2C
  • OTRPC4
  • SMAL
  • SPSMA
  • SSQTL1
  • TRP12
  • VRL2
  • VROAC
  • 0610033B08Rik
  • Trp12
  • VR-OAC
  • VRL-2
  • Otrpc4
  • Vroac
  • transient receptor potential cation channel, subfamily V, member 4
  • transient receptor potential cation channel subfamily V member 4
  • trpv4
  • TRPV4
  • Trpv4
Epitope
Middle Region
16
14
8
7
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
Reactivity
Human
106
65
63
7
7
6
4
3
2
2
2
1
1
Host
Rabbit
109
6
1
Clonality
Polyclonal
Conjugate
This TRPV4 antibody is un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
82
41
40
14
13
6
2
1
1
Options
Immunogen TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Specificity TRPV4 antibody was raised against the middle region of TRPV4
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others TRPV4 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name TRPV4 (TRPV4 Antibody Abstract)
Background TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.
Molecular Weight 91 kDa (MW of target protein)
Pathways Hormone Transport, Cell-Cell Junction Organization
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4) (Middle Region) antibody (ABIN633742) TRPV4 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?