TRPV4 antibody (Middle Region)
-
- Target See all TRPV4 Antibodies
- TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPV4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPV4 antibody was raised against the middle region of TRPV4
- Purification
- Affinity purified
- Immunogen
- TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
- Top Product
- Discover our top product TRPV4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))
- Alternative Name
- TRPV4 (TRPV4 Products)
- Background
- TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.
- Molecular Weight
- 91 kDa (MW of target protein)
- Pathways
- Hormone Transport, Cell-Cell Junction Organization
-