TRPV4 antibody (Middle Region)

Catalog No. ABIN633742

Product Details anti-TRPV4 Antibody

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPV4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRPV4 antibody was raised against the middle region of TRPV4

Purification: Affinity purified

Immunogen: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPV4

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Alternative Name: TRPV4 (TRPV4 Products)

Synonyms: wu:fp52e02 antibody, CMT2C antibody, HMSN2C antibody, OTRPC4 antibody, SMAL antibody, SPSMA antibody, SSQTL1 antibody, TRP12 antibody, VRL2 antibody, VROAC antibody, 0610033B08Rik antibody, Trp12 antibody, VR-OAC antibody, VRL-2 antibody, Otrpc4 antibody, Vroac antibody, transient receptor potential cation channel, subfamily V, member 4 antibody, transient receptor potential cation channel subfamily V member 4 antibody, trpv4 antibody, TRPV4 antibody, Trpv4 antibody

Background: TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization