APOE antibody (N-Term)
-
- Target See all APOE Antibodies
- APOE (Apolipoprotein E (APOE))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ApoE antibody was raised against the N terminal of APOE
- Purification
- Affinity purified
- Immunogen
- ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
- Top Product
- Discover our top product APOE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoE Blocking Peptide, catalog no. 33R-4716, is also available for use as a blocking control in assays to test for specificity of this ApoE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOE (Apolipoprotein E (APOE))
- Alternative Name
- ApoE (APOE Products)
- Synonyms
- ad2 antibody, apoprotein antibody, im:7036787 antibody, wu:fb69a05 antibody, zgc:110064 antibody, apoe antibody, AI255918 antibody, AD2 antibody, LDLCQ5 antibody, LPG antibody, APOEA antibody, Apo-E antibody, apolipoprotein E antibody, apolipoprotein Ea antibody, apoe antibody, apoea antibody, Apoe antibody, APOE antibody
- Background
- Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
- Molecular Weight
- 34 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size, Lipid Metabolism
-