APOE antibody (Apolipoprotein E) (N-Term)

Details for Product anti-APOE Antibody No. ABIN633837
Antigen
Epitope
N-Term
17
15
11
6
5
4
4
4
4
4
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
271
79
48
5
5
2
2
2
2
1
1
Host
Rabbit
169
81
67
1
Clonality
Polyclonal
Conjugate
This APOE antibody is un-conjugated
28
15
14
5
5
5
5
5
4
3
3
3
1
1
1
1
1
Application
Western Blotting (WB)
226
173
86
53
19
18
16
15
12
12
6
5
4
3
3
2
2
2
1
1
1
1
Options
Immunogen ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Specificity ApoE antibody was raised against the N terminal of APOE
Purification Affinity purified
Antigen
Alternative Name ApoE (APOE Antibody Abstract)
Background Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Molecular Weight 34 kDa (MW of target protein)
Pathways Regulation of Cell Size, Lipid Metabolism
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ApoE Blocking Peptide, catalog no. 33R-4716, is also available for use as a blocking control in assays to test for specificity of this ApoE antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Apolipoprotein E (APOE) (N-Term) antibody (ABIN633837) ApoE antibody used at 1 ug/ml to detect target protein.
Image no. 2 for anti-Apolipoprotein E (APOE) (N-Term) antibody (ABIN633837) ApoE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magn...
Image no. 3 for anti-Apolipoprotein E (APOE) (N-Term) antibody (ABIN633837) ApoE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magn...