Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Afamin antibody (AFM) (Middle Region) Primary Antibody

AFM Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633872
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Afamin (AFM)
    Binding Specificity
    Middle Region
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 44
    • 22
    • 16
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Host
    Rabbit
    • 40
    • 7
    • 3
    • 1
    Clonality
    Polyclonal
    • 49
    • 2
    Conjugate
    This Afamin antibody is un-conjugated
    • 24
    • 7
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 37
    • 15
    • 13
    • 12
    • 6
    • 6
    • 3
    • 3
    • 1
    • 1
    • 1
    Specificity
    Afamin antibody was raised against the middle region of AFM
    Purification
    Affinity purified
    Immunogen
    Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
  • Application Notes
    WB: 0.5 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFM antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Afamin (AFM)
    Alternative Name
    Afamin (AFM Antibody Abstract)
    Synonyms
    AFM, ALB2, ALBA, ALF, Alf, alpha-Alb, afamin, AFM, Afm
    Background
    AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
    Molecular Weight
    69 kDa (MW of target protein)
You are here:
help Support