Afamin antibody (Middle Region)
-
- Target See all Afamin (AFM) Antibodies
- Afamin (AFM)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Afamin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Afamin antibody was raised against the middle region of AFM
- Purification
- Affinity purified
- Immunogen
- Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
- Top Product
- Discover our top product AFM Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Afamin (AFM)
- Alternative Name
- Afamin (AFM Products)
- Background
- AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
- Molecular Weight
- 69 kDa (MW of target protein)
-