SPINK1 antibody (N-Term)
-
- Target See all SPINK1 Antibodies
- SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPINK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SPINK1 antibody was raised against the N terminal of SPINK1
- Purification
- Affinity purified
- Immunogen
- SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG
- Top Product
- Discover our top product SPINK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPINK1 Blocking Peptide, catalog no. 33R-4724, is also available for use as a blocking control in assays to test for specificity of this SPINK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPINK1 (serine Peptidase Inhibitor, Kazal Type 1 (SPINK1))
- Alternative Name
- SPINK1 (SPINK1 Products)
- Background
- SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.
- Molecular Weight
- 8 kDa (MW of target protein)
-