Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Albumin antibody (ALB) (Middle Region) Primary Antibody

ALB Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Pubmed (2)
Catalog No. ABIN633910
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Albumin (ALB)
    Binding Specificity
    Middle Region
    • 12
    • 5
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 208
    • 90
    • 82
    • 81
    • 42
    • 36
    • 33
    • 30
    • 30
    • 28
    • 24
    • 22
    • 21
    • 14
    • 10
    • 9
    • 9
    • 4
    • 3
    • 2
    • 2
    • 1
    Host
    Rabbit
    • 368
    • 84
    • 69
    • 23
    • 13
    • 10
    • 4
    • 2
    Clonality
    Polyclonal
    Conjugate
    This Albumin antibody is un-conjugated
    • 261
    • 94
    • 84
    • 64
    • 10
    • 10
    • 8
    • 8
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Application
    Western Blotting (WB)
    • 315
    • 315
    • 199
    • 103
    • 89
    • 70
    • 59
    • 54
    • 48
    • 47
    • 31
    • 31
    • 29
    • 27
    • 19
    • 19
    • 18
    • 18
    • 14
    • 8
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    Specificity
    Albumin antibody was raised against the middle region of ALB
    Purification
    Affinity purified
    Immunogen
    Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    Albumin Blocking Peptide, catalog no. 33R-5421, is also available for use as a blocking control in assays to test for specificity of this Albumin antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Canuel, Bhattacharyya, Balbis, Yuan, Morales: "Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, 2008 (PubMed).

    Clavant, Sastra, Osicka, Comper: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." in: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, 2006 (PubMed).

  • Target
    Albumin (ALB)
    Alternative Name
    Albumin (ALB Antibody Abstract)
    Synonyms
    PRO0883, PRO0903, PRO1341, ALB, CSA, Alb-1, Alb1, Albza, LOC100136344, Alb, FBF-1, alb-a, alb-b, albumin, serum albumin 1, Fas binding factor 1, albumin S homeolog, ALB, Alb, LOC100136344, FBF1, alb.S
    Background
    Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.
    Molecular Weight
    67 kDa (MW of target protein)
    Pathways
    Lipid Metabolism
You are here:
help Support