Albumin antibody (ALB) (N-Term)

Details for Product anti-ALB Antibody No. ABIN633959
Antigen
Epitope
N-Term
16
14
6
5
5
4
3
3
3
3
2
2
2
1
1
1
1
1
1
Reactivity
Human
499
156
152
146
68
64
55
49
47
46
43
38
29
17
14
14
12
4
3
3
2
2
1
1
Host
Rabbit
726
240
120
44
22
19
5
4
2
Clonality
Polyclonal
Conjugate
This Albumin antibody is un-conjugated
159
151
108
12
11
8
8
6
6
6
6
6
6
6
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
694
657
279
111
108
107
94
68
63
61
58
58
40
28
27
19
19
18
16
12
7
5
3
3
3
2
2
Options
Immunogen Albumin antibody was raised using the N terminal of ALB corresponding to a region with amino acids YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET
Specificity Albumin antibody was raised against the N terminal of ALB
Purification Affinity purified
Antigen
Alternative Name Albumin (ALB Antibody Abstract)
Background Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.
Molecular Weight 66 kDa (MW of target protein)
Pathways Lipid Metabolism
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Albumin Blocking Peptide, catalog no. 33R-10104, is also available for use as a blocking control in assays to test for specificity of this Albumin antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Product cited in: Canuel, Bhattacharyya, Balbis, Yuan, Morales: "Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, 2008 (PubMed).

Clavant, Sastra, Osicka, Comper: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." in: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, 2006 (PubMed).