RPA4 antibody (C-Term)
-
- Target See all RPA4 Antibodies
- RPA4 (Replication Protein A4, 30kDa (RPA4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPA4 antibody was raised against the C terminal of RPA4
- Purification
- Affinity purified
- Immunogen
- RPA4 antibody was raised using the C terminal of RPA4 corresponding to a region with amino acids HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
- Top Product
- Discover our top product RPA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPA4 Blocking Peptide, catalog no. 33R-3818, is also available for use as a blocking control in assays to test for specificity of this RPA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPA4 (Replication Protein A4, 30kDa (RPA4))
- Alternative Name
- RPA4 (RPA4 Products)
- Synonyms
- HSU24186 antibody, replication protein A4 antibody, RPA4 antibody
- Background
- Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32 kDa subunit of the RPA, which associates with the 70- and 13 kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication
-