CD5 antibody (CD5 Molecule) (N-Term)

Details for Product anti-CD5 Antibody No. ABIN634761
Antigen
Epitope
N-Term
15
15
14
14
14
10
10
7
7
7
6
6
6
4
4
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
649
243
135
53
48
39
35
33
32
27
25
24
21
5
2
2
1
1
Host
Rabbit
662
168
143
Clonality
Polyclonal
Conjugate
This CD5 antibody is un-conjugated
134
115
77
63
14
14
10
9
9
7
5
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
4
3
3
3
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
734
228
205
159
146
112
77
68
54
24
14
14
14
13
12
11
4
3
2
2
1
1
1
Options
Immunogen CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Specificity CD5 antibody was raised against the N terminal of CD5
Purification Affinity purified
Antigen
Alternative Name CD5 (CD5 Antibody Abstract)
Background CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
Molecular Weight 54 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-CD5 Molecule (CD5) (N-Term) antibody (ABIN634761) CD5 antibody used at 1 ug/ml to detect target protein.