CD5 antibody (N-Term)
-
- Target See all CD5 Antibodies
- CD5
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CD5 antibody was raised against the N terminal of CD5
- Purification
- Affinity purified
- Immunogen
- CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
- Top Product
- Discover our top product CD5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD5
- Alternative Name
- CD5 (CD5 Products)
- Background
- CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.
- Molecular Weight
- 54 kDa (MW of target protein)
-