Glyco antibody

Details for Product No. ABIN634766
Antigen
Reactivity
Human
1
Host
Rabbit
1
Clonality
Polyclonal
Application
Western Blotting (WB)
1
Options
Immunogen Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Purification Affinity purified
Antigen
Background Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.
Molecular Weight 68 kDa (MW of target protein)
Application Notes WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Glycoprotein Ib Blocking Peptide, catalog no. 33R-7939, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein Ib antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP0 A antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Glyco antibody (ABIN634766) Glycoprotein Ib antibody used at 0.25 ug/ml to detect target protein.