APP antibody (Amyloid beta (A4) Precursor Protein) (Middle Region)

Details for Product anti-APP Antibody No. ABIN634768
Antigen
Epitope
Middle Region
84
74
60
37
34
29
19
17
15
13
12
12
10
10
10
10
8
8
8
7
7
7
7
6
5
5
5
4
4
4
4
4
4
4
4
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
803
331
324
39
20
18
15
14
12
11
11
7
5
4
2
2
2
2
2
2
1
Host
Rabbit
587
208
32
8
1
Clonality
Polyclonal
Conjugate
This APP antibody is un-conjugated
53
38
36
16
16
16
16
14
14
13
13
13
10
10
10
10
10
3
3
2
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
558
334
298
124
122
88
56
49
40
22
17
16
14
10
8
3
3
3
2
1
1
Options
Immunogen APP antibody was raised using the middle region of APP corresponding to a region with amino acids DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQV
Specificity APP antibody was raised against the middle region of APP
Purification Affinity purified
Antigen
Alternative Name APP (APP Antibody Abstract)
Background APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Weight 85 kDa (MW of target protein)
Pathways Caspase Cascade in Apoptosis, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

APP Blocking Peptide, catalog no. 33R-2119, is also available for use as a blocking control in assays to test for specificity of this APP antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.