Enkephalin antibody (Middle Region)
-
- Target See all Enkephalin (PENK) Antibodies
- Enkephalin (PENK) (Proenkephalin (PENK))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Enkephalin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PENK antibody was raised against the middle region of PENK
- Purification
- Affinity purified
- Immunogen
- PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
- Top Product
- Discover our top product PENK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Enkephalin (PENK) (Proenkephalin (PENK))
- Alternative Name
- PENK (PENK Products)
- Background
- Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
- Molecular Weight
- 31 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-