Enkephalin antibody (Proenkephalin) (Middle Region)

Details for Product anti-PENK Antibody No. ABIN634799
Antigen
Epitope
Middle Region
15
8
7
7
3
3
2
2
2
2
1
1
1
1
Reactivity
Human
63
13
9
5
5
2
2
2
1
1
1
1
1
Host
Rabbit
59
12
8
Clonality
Polyclonal
Conjugate
This Enkephalin antibody is un-conjugated
5
4
3
3
3
3
1
1
1
1
1
1
Application
Western Blotting (WB)
51
44
38
15
11
10
9
6
5
4
3
3
2
Options
Immunogen PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
Specificity PENK antibody was raised against the middle region of PENK
Purification Affinity purified
Antigen
Alternative Name PENK (PENK Antibody Abstract)
Background Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
Molecular Weight 31 kDa (MW of target protein)
Pathways Stem Cell Maintenance
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Proenkephalin (PENK) (Middle Region) antibody (ABIN634799) PENK antibody used at 1 ug/ml to detect target protein.