Enkephalin antibody (Middle Region)

Catalog No. ABIN634799

Product Details anti-Enkephalin Antibody

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Enkephalin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PENK antibody was raised against the middle region of PENK

Purification: Affinity purified

Immunogen: PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Enkephalin

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Alternative Name: PENK (PENK Products)

Synonyms: AI326464 antibody, ENK antibody, PPA antibody, Penk1 antibody, PENK antibody, penk antibody, Enk antibody, Penk-rs antibody, Penk2 antibody, penkl antibody, zgc:73353 antibody, Penk antibody, proenkephalin antibody, preproenkephalin antibody, proenkephalin b antibody, proenkephalin L homeolog antibody, proenkephalin a antibody, PENK antibody, Penk antibody, penk antibody, penkb antibody, penk.L antibody, penka antibody

Background: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Stem Cell Maintenance