Arylsulfatase H antibody (ARSH) (Middle Region)

Details for Product anti-ARSH Antibody No. ABIN634839
Antigen
Epitope
Middle Region
7
4
4
1
1
1
Reactivity
Human
46
3
2
2
2
2
1
1
Host
Rabbit
36
7
4
Clonality
Polyclonal
Conjugate
This Arylsulfatase H antibody is un-conjugated
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
20
15
13
3
1
1
1
Options
Immunogen ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
Specificity ARSH antibody was raised against the middle region of ARSH
Purification Affinity purified
Antigen
Alternative Name ARSH (ARSH Antibody Abstract)
Background Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
Molecular Weight 63 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Arylsulfatase H (ARSH) (Middle Region) antibody (ABIN634839) ARSH antibody used at 1 ug/ml to detect target protein.