Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

LMF2 antibody (Lipase Maturation Factor 2) (Middle Region) Primary Antibody

LMF2 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634844
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    LMF2
    Binding Specificity
    Middle Region
    • 9
    • 8
    • 8
    • 4
    • 1
    • 1
    Reactivity
    Human, Mouse, Rat
    • 24
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This LMF2 antibody is un-conjugated
    • 9
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    Application
    Western Blotting (WB)
    • 21
    • 20
    • 15
    • 2
    • 1
    • 1
    • 1
    Specificity
    LMF2 antibody was raised against the middle region of LMF2
    Purification
    Affinity purified
    Immunogen
    LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    LMF2
    Alternative Name
    LMF2 (LMF2 Antibody Abstract)
    Synonyms
    TMEM112B, TMEM153, RGD1306274, Tmem112b, xlmf2, BC002942, zgc:194766, MGC145062, AI451006, Tmem153, im:7150505, im:7152257, lmf2, tmem112b, tmem153, lipase maturation factor 2, lipase maturation factor 2 L homeolog, lipase maturation factor 2a, lipase maturation factor 2b, LMF2, Lmf2, lmf2.L, lmf2a, lmf2, PITG_09785, Tsp_02101, lmf2b
    Background
    LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
    Molecular Weight
    77 kDa (MW of target protein)
You are here:
help Support