LMF2 antibody (Lipase Maturation Factor 2) (Middle Region)

Details for Product anti-LMF2 Antibody No. ABIN634844
Antigen
Epitope
Middle Region
9
9
8
4
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
28
7
6
2
2
2
2
2
2
1
1
1
Host
Rabbit
28
Clonality
Polyclonal
Conjugate
This LMF2 antibody is un-conjugated
3
3
3
2
2
2
Application
Western Blotting (WB)
25
23
16
4
1
1
1
Options
Immunogen LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
Specificity LMF2 antibody was raised against the middle region of LMF2
Purification Affinity purified
Antigen
Alternative Name LMF2 (LMF2 Antibody Abstract)
Background LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
Molecular Weight 77 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Lipase Maturation Factor 2 (LMF2) (Middle Region) antibody (ABIN634844) LMF2 antibody used at 1 ug/ml to detect target protein.