ABCF3 antibody
-
- Target See all ABCF3 products
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCF3 Blocking Peptide, catalog no. 33R-1883, is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))
- Alternative Name
- ABCF3 (ABCF3 Products)
- Synonyms
- ABCF3 antibody, DKFZp459M1517 antibody, EST201864 antibody, AI326318 antibody, AU016058 antibody, BB119416 antibody, ATP binding cassette subfamily F member 3 antibody, ATP-binding cassette sub-family F member 3 antibody, ATP-binding cassette, sub-family F (GCN20), member 3 antibody, ABCF3 antibody, CpipJ_CPIJ014150 antibody, PTRG_01254 antibody, PTRG_00878 antibody, VDBG_00967 antibody, MGYG_07201 antibody, Abcf3 antibody
- Background
- ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
- Molecular Weight
- 78 kDa (MW of target protein)
-