ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3) antibody

Details for Product No. ABIN634851
Antigen
Reactivity
Human, Mouse (Murine), Rat (Rattus)
61
33
31
8
5
5
4
4
4
1
1
Host
Rabbit
53
7
1
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
29
27
15
13
4
1
1
Options
Immunogen ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL
Purification Affinity purified
Antigen
Alternative Name ABCF3
Background ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.
Molecular Weight 78 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ABCF3 Blocking Peptide, catalog no. 33R-1883, is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3) antibody (ABIN634851) ABCF3 antibody used at 1 ug/ml to detect target protein.