SEC22C antibody
-
- Target See all SEC22C Antibodies
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SEC22C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
- Top Product
- Discover our top product SEC22C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEC22C (SEC22 Vesicle Trafficking Protein Homolog C (SEC22C))
- Alternative Name
- SEC22C (SEC22C Products)
- Synonyms
- 4932412K21 antibody, 5930407I15Rik antibody, C530046H07 antibody, Sec22l3 antibody, SEC22L3 antibody, SEC22 homolog C, vesicle trafficking protein antibody, Sec22c antibody, SEC22C antibody
- Background
- The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.
- Molecular Weight
- 34 kDa (MW of target protein)
-