SEC22C antibody (SEC22 Vesicle Trafficking Protein Homolog C (S. Cerevisiae))

Details for Product anti-SEC22C Antibody No. ABIN634875
Target
Reactivity
Human
5
3
2
2
2
2
2
1
1
Host
Rabbit
4
1
Clonality
Polyclonal
Application
Western Blotting (WB)
5
2
1
Options
Immunogen SEC22 C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
Purification Affinity purified
Target
Alternative Name SEC22C (SEC22C Antibody Abstract)
Background The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.
Molecular Weight 34 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC20 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-SEC22 Vesicle Trafficking Protein Homolog C (S. Cerevisiae) (SEC22C) antibody (ABIN634875) SEC22C antibody used at 1 ug/ml to detect target protein.