MMP24 antibody

Catalog No. ABIN634930

Product Details anti-MMP24 Antibody

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP24 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP24

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Alternative Name: MMP24 (MMP24 Products)

Synonyms: MMP-24 antibody, MMP25 antibody, MT-MMP 5 antibody, MT-MMP5 antibody, MT5-MMP antibody, MT5MMP antibody, MTMMP5 antibody, AU040325 antibody, Mt5-mmp antibody, si:ch211-239j9.5 antibody, MMP24 antibody, mt3-mmp antibody, matrix metallopeptidase 24 antibody, matrix metallopeptidase 16 S homeolog antibody, MMP24 antibody, Mmp24 antibody, mmp24 antibody, mmp16.S antibody

Background: This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.

Molecular Weight: 57 kDa (MW of target protein)