Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24) antibody

Details for Product No. ABIN634930
Antigen
Reactivity
Human, Mouse (Murine), Rat (Rattus)
52
22
19
3
3
3
3
2
2
2
2
1
1
Host
Rabbit
52
1
Clonality
Polyclonal
Conjugate
Un-conjugated
4
2
2
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
40
23
22
8
4
3
1
1
Options
Immunogen MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
Purification Affinity purified
Antigen
Alternative Name MMP24 (MMP24 Antibody Abstract)
Background This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.
Molecular Weight 57 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24) antibody (ABIN634930) MMP24 antibody used at 1 ug/ml to detect target protein.