NDUFB5 antibody (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa)

Details for Product anti-NDUFB5 Antibody No. ABIN634974
Antigen
Reactivity
Human
31
13
10
1
1
1
1
1
Host
Rabbit
27
4
Clonality
Polyclonal
Conjugate
This NDUFB5 antibody is un-conjugated
2
2
2
Application
Western Blotting (WB)
24
16
7
4
4
3
2
1
Options
Immunogen NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS
Purification Affinity purified
Antigen
Alternative Name NDUFB5 (NDUFB5 Antibody Abstract)
Background NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Molecular Weight 17 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

NDUFB5 Blocking Peptide, catalog no. 33R-4521, is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5) antibody (ABIN634974) NDUFB5 antibody used at 1 ug/ml to detect target protein.