NDUFB5 antibody
-
- Target See all NDUFB5 Antibodies
- NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDUFB5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS
- Top Product
- Discover our top product NDUFB5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDUFB5 Blocking Peptide, catalog no. 33R-4521, is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))
- Alternative Name
- NDUFB5 (NDUFB5 Products)
- Synonyms
- hm:zeh0024 antibody, zgc:123331 antibody, 0610007D05Rik antibody, AU015782 antibody, SGDH antibody, CISGDH antibody, NADH:ubiquinone oxidoreductase subunit B5 antibody, NADH:ubiquinone oxidoreductase subunit B5 L homeolog antibody, NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5 antibody, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa antibody, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5 antibody, Ndufb5 antibody, ndufb5.L antibody, NDUFB5 antibody, ndufb5 antibody
- Background
- NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
- Molecular Weight
- 17 kDa (MW of target protein)
-