Transmembrane Protein 195 (TMEM195) (Middle Region) antibody

Details for Product No. ABIN635006
Antigen
Epitope
Middle Region
5
1
1
1
Reactivity
Human
11
8
8
5
4
4
3
2
2
2
1
Host
Rabbit
11
Clonality
Polyclonal
Application
Western Blotting (WB)
11
3
Options
Immunogen TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
Specificity TMEM195 antibody was raised against the middle region of TMEM195
Purification Affinity purified
Antigen
Alternative Name TMEM195 (TMEM195 Antibody Abstract)
Background TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Molecular Weight 51 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TMEM195 Blocking Peptide, catalog no. 33R-1200, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transmembrane Protein 195 (TMEM195) (Middle Region) antibody (ABIN635006) TMEM195 antibody used at 1 ug/ml to detect target protein.