Na+/H+ Exchanger Domain Containing 2 (NHEDC2) (C-Term) antibody

Details for Product No. ABIN635063
Antigen
Epitope
C-Term
10
10
7
3
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
40
18
18
2
2
1
1
1
1
1
Host
Rabbit
37
3
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
28
16
13
3
Options
Immunogen NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI
Specificity NHEDC2 antibody was raised against the C terminal of NHEDC2
Purification Affinity purified
Antigen
Alternative Name NHEDC2 (NHEDC2 Antibody Abstract)
Background Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.
Molecular Weight 57 kDa (MW of target protein)
Pathways Proton Transport
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

NHEDC2 Blocking Peptide, catalog no. 33R-3957, is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Na+/H+ Exchanger Domain Containing 2 (NHEDC2) (C-Term) antibody (ABIN635063) NHEDC2 antibody used at 1 ug/ml to detect target protein.