OR11H12 antibody (N-Term)

Catalog No. ABIN635110

Product Details anti-OR11H12 Antibody

Target: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR11H12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OR11 H12 antibody was raised against the N terminal of OR11 12

Purification: Affinity purified

Immunogen: OR11 H12 antibody was raised using the N terminal of OR11 12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR11H12

Target: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Alternative Name: OR11H12 (OR11H12 Products)

Synonyms: olfactory receptor family 11 subfamily H member 12 antibody, OR11H12 antibody

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molecular Weight: 36 kDa (MW of target protein)