OR11H12 antibody (Olfactory Receptor, Family 11, Subfamily H, Member 12) (N-Term)

Details for Product anti-OR11H12 Antibody No. ABIN635110
Target
Binding Specificity
N-Term
2
Reactivity
Human
3
1
1
1
1
1
Host
Rabbit
3
Clonality
Polyclonal
Application
Western Blotting (WB)
3
1
Options
Immunogen OR11 H12 antibody was raised using the N terminal of OR11 12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA
Specificity OR11 H12 antibody was raised against the N terminal of OR11 12
Purification Affinity purified
Target
Alternative Name OR11H12 (OR11H12 Antibody Abstract)
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.
Molecular Weight 36 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 12 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12) (N-Term) antibody (ABIN635110) OR11H12 antibody used at 1 ug/ml to detect target protein.