OR10X1 antibody (Olfactory Receptor, Family 10, Subfamily X, Member 1) (Middle Region)

Details for Product anti-OR10X1 Antibody No. ABIN635112
Antigen
Epitope
Middle Region
10
8
8
7
3
2
2
2
1
1
Reactivity
Human, Rat (Rattus)
40
14
3
2
2
2
2
2
1
Host
Rabbit
40
Clonality
Polyclonal
Conjugate
This OR10X1 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
34
27
8
2
1
1
1
1
Options
Immunogen OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
Specificity OR10 X1 antibody was raised against the middle region of OR10 1
Purification Affinity purified
Antigen
Alternative Name OR10X1 (OR10X1 Antibody Abstract)
Background OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Molecular Weight 36 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1) (Middle Region) antibody (ABIN635112) OR10X1 antibody used at 1 ug/ml to detect target protein.