OR10X1 antibody (Middle Region)
-
- Target See all OR10X1 Antibodies
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OR10X1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OR10 X1 antibody was raised against the middle region of OR10 1
- Purification
- Affinity purified
- Immunogen
- OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
- Top Product
- Discover our top product OR10X1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
- Alternative Name
- OR10X1 (OR10X1 Products)
- Synonyms
- OR1-13 antibody, OR1-14 antibody, OR10X1P antibody, olfactory receptor family 10 subfamily X member 1 (gene/pseudogene) antibody, OR10X1 antibody
- Background
- OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Molecular Weight
- 36 kDa (MW of target protein)
-