SLCO1C1 antibody (N-Term)

Catalog No. ABIN635126

Product Details anti-SLCO1C1 Antibody

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLCO1C1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLCO1 C1 antibody was raised against the N terminal of SLCO1 1

Purification: Affinity purified

Immunogen: SLCO1 C1 antibody was raised using the N terminal of SLCO1 1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO1C1 Blocking Peptide, catalog no. 33R-9482, is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-SLCO1C1 antibody (ABIN635126)

Szczupak, Peña, Bracho, Mei, Bas, Fernandez-Valle, Liu, Telischi, Ivan, Dinh: "Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." in: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).

Target Details for SLCO1C1

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Alternative Name: SLCO1C1 (SLCO1C1 Products)

Background: SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.

Molecular Weight: 79 kDa (MW of target protein)