FMO3 antibody (Flavin Containing Monooxygenase 3) (N-Term)

Details for Product anti-FMO3 Antibody No. ABIN635154
Antigen
Epitope
N-Term
17
8
7
4
4
3
2
2
1
1
1
1
1
1
1
Reactivity
Human
87
42
38
5
5
5
4
4
3
2
2
1
1
Host
Rabbit
83
5
Clonality
Polyclonal
Conjugate
This FMO3 antibody is un-conjugated
5
4
4
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
67
28
17
13
11
4
2
1
1
1
Options
Immunogen FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
Specificity FMO3 antibody was raised against the N terminal of FMO3
Purification Affinity purified
Antigen
Alternative Name FMO3 (FMO3 Antibody Abstract)
Background FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
Molecular Weight 60 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

FMO3 Blocking Peptide, catalog no. 33R-6042, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Flavin Containing Monooxygenase 3 (FMO3) (N-Term) antibody (ABIN635154) FMO3 antibody used at 1 ug/ml to detect target protein.