SLC3A1 antibody (Solute Carrier Family 3 (Cystine, Dibasic and Neutral Amino Acid Transporters, Activator of Cystine, Dibasic and Neutral Amino Acid Transport), Member 1) (N-Term)

Details for Product anti-SLC3A1 Antibody No. ABIN635179
Antigen
Epitope
N-Term
8
6
4
3
2
1
1
1
1
Reactivity
Human
50
13
13
2
2
2
2
2
2
2
1
1
Host
Rabbit
40
10
Clonality
Polyclonal
Conjugate
This SLC3A1 antibody is un-conjugated
3
2
2
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
42
25
12
8
3
2
1
1
1
1
Options
Immunogen SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT
Specificity SLC3 A1 antibody was raised against the N terminal of SLC3 1
Purification Affinity purified
Antigen
Alternative Name SLC3A1 (SLC3A1 Antibody Abstract)
Background This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.
Molecular Weight 79 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 3 (Cystine, Dibasic and Neutral Amino Acid Transporters, Activator of Cystine, Dibasic and Neutral Amino Acid Transport), Member 1 (SLC3A1) (N-Term) antibody (ABIN635179) SLC3A1 antibody used at 1 ug/ml to detect target protein.