SLC3A1 antibody (N-Term)

Catalog No. ABIN635179

Product Details anti-SLC3A1 Antibody

Target: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC3A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC3 A1 antibody was raised against the N terminal of SLC3 1

Purification: Affinity purified

Immunogen: SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC3A1

Target: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Alternative Name: SLC3A1 (SLC3A1 Products)

Synonyms: D2H antibody, NBAT antibody, NTAA antibody, RBAT antibody, SLC3A1 antibody, MGC131051 antibody, ATR1 antibody, CSNU1 antibody, solute carrier family 3, member 1 antibody, solute carrier family 3 member 1 antibody, solute carrier family 3 (amino acid transporter heavy chain), member 1 L homeolog antibody, solute carrier family 3 (amino acid transporter heavy chain), member 1 antibody, Slc3a1 antibody, SLC3A1 antibody, slc3a1.L antibody, slc3a1 antibody

Background: This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.

Molecular Weight: 79 kDa (MW of target protein)