LPPR5 antibody (N-Term)
-
- Target See all LPPR5 Antibodies
- LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LPPR5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PAP2 D antibody was raised against the N terminal of PAP2
- Purification
- Affinity purified
- Immunogen
- PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
- Top Product
- Discover our top product LPPR5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))
- Alternative Name
- PAP2D (LPPR5 Products)
- Synonyms
- PAP2 antibody, PAP2D antibody, PRG5 antibody, Lppr5 antibody, PRG-5 antibody, Pap2d antibody, RGD1309567 antibody, LPPR5 antibody, lppr5b antibody, zgc:165526 antibody, phospholipid phosphatase related 5 antibody, phospholipid phosphatase related 5 L homeolog antibody, phospholipid phosphatase related 5b antibody, PLPPR5 antibody, Plppr5 antibody, plppr5.L antibody, plppr5b antibody
- Background
- PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molecular Weight
- 35 kDa (MW of target protein)
-