Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5) antibody

Catalog No. ABIN635267

Product Details

Target: Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: SLC17 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Solute Carrier Family 17 (Acidic Sugar Transporter), Member 5 (SLC17A5)

Alternative Name: SLC17A5 (SLC17A5 Products)

Background: SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.

Molecular Weight: 55 kDa (MW of target protein)