SLCO2B1 antibody (N-Term)
-
- Target See all SLCO2B1 Antibodies
- SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLCO2B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLCO2 B1 antibody was raised against the N terminal of SLCO2 1
- Purification
- Affinity purified
- Immunogen
- SLCO2 B1 antibody was raised using the N terminal of SLCO2 1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
- Top Product
- Discover our top product SLCO2B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLCO2B1 Blocking Peptide, catalog no. 33R-2111, is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))
- Alternative Name
- SLCO2B1 (SLCO2B1 Products)
- Background
- SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
- Molecular Weight
- 77 kDa (MW of target protein)
-