SLC35E2 antibody (Middle Region)
-
- Target See all SLC35E2 Antibodies
- SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC35E2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC35 E2 antibody was raised against the middle region of SLC35 2
- Purification
- Affinity purified
- Immunogen
- SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
- Top Product
- Discover our top product SLC35E2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))
- Alternative Name
- SLC35E2 (SLC35E2 Products)
- Synonyms
- Slc35e2 antibody, SLC35E2 antibody, A530082C11Rik antibody, AI957035 antibody, solute carrier family 35, member E2B antibody, solute carrier family 35 member E2B antibody, solute carrier family 35 member E3 antibody, solute carrier family 35 member E2 antibody, solute carrier family 35, member E2 antibody, Slc35e2b antibody, SLC35E2B antibody, SLC35E3 antibody, SLC35E2 antibody, Slc35e2 antibody
- Background
- SLC35E2 is a putative transporter.
- Molecular Weight
- 29 kDa (MW of target protein)
-