Solute Carrier Family 35, Member E2 (SLC35E2) (Middle Region) antibody

Details for Product No. ABIN635327
Antigen
Epitope
Middle Region
9
8
1
1
Reactivity
Human
18
2
2
Host
Rabbit
18
Clonality
Polyclonal
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
13
9
9
8
2
1
Options
Immunogen SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Specificity SLC35 E2 antibody was raised against the middle region of SLC35 2
Purification Affinity purified
Antigen
Alternative Name SLC35E2 (SLC35E2 Antibody Abstract)
Background SLC35E2 is a putative transporter.
Molecular Weight 29 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 35, Member E2 (SLC35E2) (Middle Region) antibody (ABIN635327) SLC35E2 antibody used at 1 ug/ml to detect target protein.