Solute Carrier Family 35, Member E2 (SLC35E2) (Middle Region) antibody

Catalog No. ABIN635327

Product Details

Target: Solute Carrier Family 35, Member E2 (SLC35E2)

See all Solute Carrier Family 35, Member E2 (SLC35E2) Antibodies

Binding Specificity: Middle Region

See all available epitopes across SLC35E2 antibodies

• AA 1-30 9
• N-Term 9
• C-Term 1
• Middle Region 1

Reactivity: Human

See all available reactivities across SLC35E2 antibodies

• Human 18
• Horse 2
• Rabbit 2

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

See all available conjugates across SLC35E2 antibodies

• Un-conjugated 5
• Biotin 2
• APC 1
• Alexa Fluor 488 1
• Alexa Fluor 555 1
• Alexa Fluor 594 1
• Alexa Fluor 647 1
• Alexa Fluor 680 1
• Alexa Fluor 750 1
• Alkaline Phosphatase (AP) 1
• FITC 1
• HRP 1
• PE 1

Application: Western Blotting (WB)

See all available applications across SLC35E2 antibodies

• Western Blotting (WB) 13
• Flow Cytometry (FACS) 9
• ELISA 8
• Immunohistochemistry (IHC) 8
• Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2
• Enzyme Immunoassay (EIA) 1

Specificity: SLC35 E2 antibody was raised against the middle region of SLC35 2

Purification: Affinity purified

Immunogen: SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Solute Carrier Family 35, Member E2 (SLC35E2)

Alternative Name: SLC35E2 (SLC35E2 Antibody Abstract)

Synonyms: Slc35e2, SLC35E2, A530082C11Rik, AI957035, solute carrier family 35, member E2B, solute carrier family 35 member E2B, solute carrier family 35 member E3, solute carrier family 35 member E2, solute carrier family 35, member E2, Slc35e2b, SLC35E2B, SLC35E3, SLC35E2, Slc35e2

Background: SLC35E2 is a putative transporter.

Molecular Weight: 29 kDa (MW of target protein)