SLC35E2 antibody (Middle Region)

Catalog No. ABIN635327

Product Details anti-SLC35E2 Antibody

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35E2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 E2 antibody was raised against the middle region of SLC35 2

Purification: Affinity purified

Immunogen: SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35E2

Target: SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))

Alternative Name: SLC35E2 (SLC35E2 Products)

Background: SLC35E2 is a putative transporter.

Molecular Weight: 29 kDa (MW of target protein)