AADACL4 antibody (Arylacetamide Deacetylase-Like 4) (Middle Region)

Details for Product anti-AADACL4 Antibody No. ABIN635339
Antigen
Epitope
Middle Region
4
1
1
1
Reactivity
Human
36
20
19
3
3
2
2
2
1
1
Host
Rabbit
36
Clonality
Polyclonal
Conjugate
This AADACL4 antibody is un-conjugated
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Western Blotting (WB)
16
13
6
5
3
1
Options
Immunogen AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR
Specificity AADACL4 antibody was raised against the middle region of AADACL4
Purification Affinity purified
Antigen
Alternative Name AADACL4
Background The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
Molecular Weight 46 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

AADACL4 Blocking Peptide, catalog no. 33R-4128, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Arylacetamide Deacetylase-Like 4 (AADACL4) (Middle Region) antibody (ABIN635339) AADACL4 antibody used at 1 ug/ml to detect target protein.