Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

AADACL4 antibody (Arylacetamide Deacetylase-Like 4) (Middle Region) Primary Antibody

AADACL4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635339
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    AADACL4
    Binding Specificity
    Middle Region
    • 3
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 28
    • 19
    • 18
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This AADACL4 antibody is un-conjugated
    • 12
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 14
    • 13
    • 4
    • 3
    • 3
    • 1
    Specificity
    AADACL4 antibody was raised against the middle region of AADACL4
    Purification
    Affinity purified
    Immunogen
    AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    AADACL4 Blocking Peptide, catalog no. 33R-4128, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    AADACL4
    Alternative Name
    AADACL4 ()
    Synonyms
    RGD1565761, OTTMUSG00000010747, Aadacl4, arylacetamide deacetylase like 4, arylacetamide deacetylase-like 4 S homeolog, arylacetamide deacetylase-like 4, arylacetamide deacetylase-like 4-like 3, AADACL4, aadacl4.S, aadacl4, Aadacl4, AADACL4L3, LOC100218769, LOC100713568
    Background
    The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
    Molecular Weight
    46 kDa (MW of target protein)
You are here:
help Support