ENPP2 antibody (N-Term)

Catalog No. ABIN635340

Product Details anti-ENPP2 Antibody

Target: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENPP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENPP2 antibody was raised against the N terminal of ENPP2

Purification: Affinity purified

Immunogen: ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENPP2

Target: ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))

Alternative Name: ENPP2 (ENPP2 Products)

Background: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.

Molecular Weight: 95 kDa (MW of target protein)