Calsyntenin 1 (CLSTN1) (N-Term) antibody

Details for Product No. ABIN635351
Antigen
Epitope
N-Term
16
11
5
3
2
1
Reactivity
Human
65
22
21
2
2
2
2
2
1
1
1
1
Host
Rabbit
66
Clonality
Polyclonal
Conjugate
Un-conjugated
5
3
3
3
3
3
3
3
3
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
42
26
13
8
5
2
1
1
Options
Immunogen Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
Specificity Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
Purification Affinity purified
Antigen
Alternative Name Calsyntenin 1 (CLSTN1 Antibody Abstract)
Background CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
Molecular Weight 110 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Calsyntenin 1 (CLSTN1) (N-Term) antibody (ABIN635351) Calsyntenin 1 antibody used at 1 ug/ml to detect target protein.