Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6) antibody

Details for Product No. ABIN635370
Antigen
Reactivity
Human
12
2
2
2
2
2
1
1
1
Host
Rabbit
12
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
6
3
1
1
Options
Immunogen SLC16 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
Purification Affinity purified
Antigen
Alternative Name SLC16A6
Background SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Molecular Weight 57 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC16A6 Blocking Peptide, catalog no. 33R-4049, is also available for use as a blocking control in assays to test for specificity of this SLC16A6 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 6 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6) antibody (ABIN635370) SLC16A6 antibody used at 1 ug/ml to detect target protein.