SLC16A6 antibody

Catalog No. ABIN635370

Product Details anti-SLC16A6 Antibody

Target: SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC16A6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC16 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC16A6 Blocking Peptide, catalog no. 33R-4049, is also available for use as a blocking control in assays to test for specificity of this SLC16A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC16A6

Target: SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))

Alternative Name: SLC16A6 (SLC16A6 Products)

Background: SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Molecular Weight: 57 kDa (MW of target protein)