Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) antibody

Details for Product No. ABIN635416
Antigen
Epitope
N-Term
4
3
Reactivity
Human
15
1
Host
Rabbit
10
5
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
10
6
1
1
Options
Immunogen KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
Specificity KLRC3 antibody was raised against the N terminal of KLRC3
Purification Affinity purified
Antigen
Alternative Name KLRC3 (KLRC3 Antibody Abstract)
Background Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.
Molecular Weight 27 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

KLRC3 Blocking Peptide, catalog no. 33R-6452, is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3) (N-Term) antibody (ABIN635416) KLRC3 antibody used at 1 ug/ml to detect target protein.