SYNGR4 antibody (Synaptogyrin 4) (N-Term)

Details for Product anti-SYNGR4 Antibody No. ABIN635439
Antigen
Epitope
N-Term
16
Reactivity
Human
37
25
23
2
2
1
1
1
Host
Rabbit
30
7
Clonality
Polyclonal
Conjugate
This SYNGR4 antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
25
18
13
5
5
2
1
1
Options
Immunogen Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
Specificity Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4
Purification Affinity purified
Antigen
Alternative Name Synaptogyrin 4 (SYNGR4 Antibody Abstract)
Background SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.
Molecular Weight 26 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Synaptogyrin 4 (SYNGR4) (N-Term) antibody (ABIN635439) Synaptogyrin 4 antibody used at 1 ug/ml to detect target protein.