SYNGR4 antibody (N-Term)

Catalog No. ABIN635439

Product Details anti-SYNGR4 Antibody

Target: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYNGR4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Synaptogyrin 4 antibody was raised against the N terminal of SYNGR4

Purification: Affinity purified

Immunogen: Synaptogyrin 4 antibody was raised using the N terminal of SYNGR4 corresponding to a region with amino acids MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synaptogyrin 4 Blocking Peptide, catalog no. 33R-6093, is also available for use as a blocking control in assays to test for specificity of this Synaptogyrin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNGR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYNGR4

Target: SYNGR4 (Synaptogyrin 4 (SYNGR4))

Alternative Name: Synaptogyrin 4 (SYNGR4 Products)

Synonyms: 1700016O14Rik antibody, synaptogyrin 4 antibody, SYNGR4 antibody, Syngr4 antibody

Background: SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.

Molecular Weight: 26 kDa (MW of target protein)