Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calcitonin-Related Polypeptide alpha (CALCA) antibody

Antigen

Calcitonin-Related Polypeptide alpha (CALCA)
Synonyms CALCA, CALC3, MGC152154, CT, KC, CGRP, CALC1, CGRP1, CGRP-I, MGC126648, CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, CALC, calcitonin, calca, ci-ct
Clonality Polyclonal
Host
Reactivity
Alternatives

Human
Application
Alternatives Radioimmunoassay (RIA)
Catalog no. ABIN109808
Quantity 100 µl  (Variants)
Price 455.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 3 to 5 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name Calcitonin-Gene related Peptide
Gene ID LocusID 797
Immunogen Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)
Description Serum
Specificity Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin

Application Details
Alternatives Secondary Antibodies Variants back to top

Application Notes RIA (1/3,000)
Storage 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided
Research Area Hormones
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Calcitonin-Related Polypeptide alpha (CALCA)", type "Antibodies"
Hosts Rabbit (89), Mouse (14), Goat (6), Sheep (4), Chicken (2), Guinea Pig (2)
Reactivities Human (103), Rat (Rattus) (36), Dog (Canine) (27), Mouse (Murine) (20), Pig (Porcine) (10), Sheep (Ovine) (10), Monkey (7), Rabbit (7), Hamster (6), Cow (Bovine) (3), Mammalian (3), Horse (Equine) (2), Chicken (1), Guinea Pig (1), Reptile (1), Zebrafish (Danio rerio) (1)
Applications Immunofluorescence (IF) (47), Flow Cytometry (FACS) (36), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (34), Immunohistochemistry (Frozen Sections) (IHC (fro)) (22), Radioimmunoassay (RIA) (19), Western Blotting (WB) (19), Enzyme Immunoassay (EIA) (17), ELISA (12), Immunohistochemistry (IHC) (9), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (4), Immunoprecipitation (IP) (4), ELISA (Capture) (2), Immunoelectron Microscopy (IEM) (2), ELISA (Detection) (1)
Conjugates Biotin (6), Alexa Flour 488 (2), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2)
Epitopes AA 1-32 (6), C-Term (2)