Forkhead Box N3 (FOXN3) (C-Term) antibody

Details for Product No. ABIN1107269
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CHES1, PRO1635, C14orf116, 5430426H20Rik, AA589593, AW556347, Ches1, Ches1l, HTLFL1, ches1, foxn3, foxn3a, FOXN3, pro1635, zgc:136571, foxn3b
Epitope
C-Term
(3), (2), (2), (1), (1)
Reactivity
Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis
(15), (2), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(11), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN1107269
Quantity 0.1 mg
Price
335.50 $   Plus shipping costs $45.00
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1
Sequence SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL
Purification Purified using Protein A affinity column
Alternative Name FOXN3 / CHES1
Background Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway.
Alternate names: C14orf116, CHES-1, Checkpoint suppressor 1, FOX-N3, Forkhead box protein N3
Gene ID 1112
NCBI Accession NP_001078940
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Yu, Zhang, Zhou et al.: "Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs." in: Genome research, Vol. 11, Issue 8, pp. 1392-403, 2001 (PubMed).

Hosts (11), (4)
Reactivities (15), (2), (2), (2), (1), (1), (1), (1)
Applications (12), (2), (2), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top