ZNF76 antibody (Middle Region)
-
- Target See all ZNF76 Antibodies
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog, Cow, Pig
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF76 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK
- Cross-Reactivity (Details)
- Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human
- Purification
- Purified using peptide immunoaffinity column
- Immunogen
- The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76
- Top Product
- Discover our top product ZNF76 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))
- Alternative Name
- ZNF76 (ZNF76 Products)
- Background
- ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76
- Gene ID
- 7629
- NCBI Accession
- NP_003418
-