Zinc Finger Protein 512 (ZNF512) antibody

Antigen: Zinc Finger Protein 512 (ZNF512)

Synonyms: FLJ51176, KIAA1805, MGC111046, Zfp512, RGD1561526, ZNF512, MGC142837, DKFZp459C096, DKFZp459N067, DKFZp469L1621

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182323

Additional Information

Alternative name: ZNF512

Gene ID: ZNF512

UniProt: Q96ME7

Immunogen: The immunogen for anti-ZNF512 antibody: synthetic peptide directed towards the middle region of human ZNF512

Sequence: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTV LKRLGKLRCM

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF512 antibody concentration is 1 mg/ml.

Description: ZNF512 is a new candidate transcription factor.

Characteristics: Antigen Size: 567 amino acids

Molecular Weight: 65kDa

Application Details

Application Notes: WB Suggested Anti-ZNF512 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF512 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).