Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SEC14-Like 2 (S. Cerevisiae) (SEC14L2) antibody

Antigen

SEC14-Like 2 (S. Cerevisiae) (SEC14L2)

Synonyms SPF, TAP, TAP1, C22orf6, KIAA1186, KIAA1658, MGC65053
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182411
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SEC14L2
Gene ID SEC14L2
UniProt O76054
Immunogen The immunogen for anti-SEC14L2 antibody: synthetic peptide directed towards the middle region of human SEC14L2
Sequence MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQI SRGSSHQVEY
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SEC14L2 antibody concentration is 1 mg/ml.
Description SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway.
Characteristics Antigen Size: 403 amino acids
Molecular Weight 46kDa

Application Details

Application Notes WB Suggested Anti-SEC14L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:7812500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "SEC14-Like 2 (S. Cerevisiae) (SEC14L2)", type "Antibodies"
Hosts Rabbit (19), Mouse (5)
Reactivities Human (24), Mouse (Murine) (18), Rat (Rattus) (17), Dog (Canine) (1), Monkey (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (9), ELISA (3), Flow Cytometry (FACS) (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1), N-Term (1)