Zinc Finger and BTB Domain Containing 32 (ZBTB32) antibody

Antigen: Zinc Finger and BTB Domain Containing 32 (ZBTB32)

Synonyms: Rog, FAXF, FAZF, PLZP, Tzfp, 4930524C15Rik, ZBTB32

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN182431

Additional Information

Alternative name: ZBTB32 / FAZF

Gene ID: ZBTB32

UniProt: Q8WVP2

Immunogen: The immunogen for anti-ZBTB32 antibody: synthetic peptide directed towards the N terminal of human ZBTB32

Sequence: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHS LVLAGVSQQL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZBTB32 antibody concentration is 1 mg/ml.

Description: ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.

Characteristics: Antigen Size: 302 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: HepG2 cell lysate

Publications

Product: Hoatlin, Zhi, Ball et al.: "A novel BTB/POZ transcriptional repressor protein interacts with the Fanconi anemia group C protein and PLZF." in: Blood, Vol. 94, Issue 11, pp. 3737-47, 1999 (PubMed).