Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 828 (ZNF828) antibody

Antigen

Zinc Finger Protein 828 (ZNF828)
Synonyms C13orf8, FLJ90413, KIAA1802
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Rat (Rattus), Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182434
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Zinc Finger Protein 828 (ZNF828) antibody

anti-Zinc Finger Protein 828 (ZNF828) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name ZNF828
Gene ID C13ORF8
UniProt Q96JM3
Immunogen The immunogen for anti-C13ORF8 antibody: synthetic peptide directed towards the middle region of human C13ORF8
Sequence PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEP RRPAPAVSPG
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-C13ORF8 antibody concentration is 1 mg/ml.
Description The function of the C13orf8 gene has not yet been determined.
Characteristics Antigen Size: 812 amino acids
Molecular Weight 89kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-C13ORF8 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Daudi cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Zinc Finger Protein 828 (ZNF828)", type "Antibodies"
Hosts Rabbit (21)
Reactivities Human (21), Mouse (Murine) (19), Rat (Rattus) (19)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1)